Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM161624 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescence Polarisation Assay |
---|
pH | 7.4±n/a |
---|
IC50 | 3.5±n/a nM |
---|
Comments | extracted |
---|
Citation | Le Tiran, A; Le Diguarher, T; Starck, J; Henlin, J; Guillouzic, A; De Nanteuil, G; Geneste, O; Fejes, I; Tatai, J; Nyerges, M; Davidson, JE; Murray, JB; Chen, I; Durand, D Pyrrole compounds, a process for their preparation and pharmaceutical compositions containing them US Patent US9108983 Publication Date 8/18/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM161624 |
---|
n/a |
---|
Name | BDBM161624 |
Synonyms: | US9108983, Example 441 |
Type | Small organic molecule |
Emp. Form. | C41H41ClN6O3 |
Mol. Mass. | 701.256 |
SMILES | Cc1c(cc(C#N)n1C)N(C(=O)c1cc(-c2cc(Cl)ccc2C(=O)N2Cc3ccccc3C[C@H]2CN2CCOCC2)n(C)c1C)c1ccccc1 |
Structure |
|