Reaction Details |
| Report a problem with these data |
Target | Fibroblast growth factor 2 |
---|
Ligand | BDBM167947 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | VEGFR2 Kinase Assay |
---|
pH | 7.2±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 401.86±0.0 nM |
---|
Comments | extracted |
---|
Citation | Yin, Y; Sha, S; Wang, YT; Wu, X; Wang, SF; Qiao, F; Lv, PC; Zhu, HL Discovery of new 4-alkoxyquinazoline-based derivatives as potent VEGFR2 inhibitors. Chem Biol Drug Des86:1323-9 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fibroblast growth factor 2 |
---|
Name: | Fibroblast growth factor 2 |
Synonyms: | Basic fibroblast growth factor | FGF-2 | FGF2 | FGF2_HUMAN | FGFB | Fibroblast growth factor 2 (bFGF) | Fibroblast growth factor receptor 2 (FGF-2) | HBGF-2 | Heparin-binding growth factor 2 |
Type: | Protein |
Mol. Mass.: | 30803.89 |
Organism: | Homo sapiens (Human) |
Description: | P09038 |
Residue: | 288 |
Sequence: | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
|
|
|
BDBM167947 |
---|
n/a |
---|
Name | BDBM167947 |
Synonyms: | 1-(4-(3-Chlorophenyl)piperazin-1-yl)-3-(quinazolin-4-yloxy)propan-2-ol (3c) |
Type | Small organic molecule |
Emp. Form. | C21H23ClN4O2 |
Mol. Mass. | 398.886 |
SMILES | OC(COc1ncnc2ccccc12)CN1CCN(CC1)c1cccc(Cl)c1 |
Structure |
|