Reaction Details |
| Report a problem with these data |
Target | Ribonuclease pancreatic |
---|
Ligand | BDBM173609 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Ribonuclease Activity Assay |
---|
Temperature | 303.15±n/a K |
---|
Ki | 2.65e+5± 4.97e+4 nM |
---|
Comments | extracted |
---|
Citation | Chatzileontiadou, DS; Parmenopoulou, V; Manta, S; Kantsadi, AL; Kylindri, P; Griniezaki, M; Kontopoulou, F; Telopoulou, A; Prokova, H; Panagopoulos, D; Boix, E; Balatsos, NA; Komiotis, D; Leonidas, DD Triazole double-headed ribonucleosides as inhibitors of eosinophil derived neurotoxin. Bioorg Chem63:152-65 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ribonuclease pancreatic |
---|
Name: | Ribonuclease pancreatic |
Synonyms: | CAM-RNase A | RNAS1_BOVIN | RNASE1 | RNAse A | RNS1 |
Type: | Enzyme |
Mol. Mass.: | 16468.79 |
Organism: | Bison bison (American bison) |
Description: | carboxamidomethylated RNase A |
Residue: | 150 |
Sequence: | MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
|
BDBM173609 |
---|
n/a |
---|
Name | BDBM173609 |
Synonyms: | 1-[3'-[4-[(Adenine-9-yl)methyl]-1,2,3-triazol-1-yl]-b-D-ribofuranosyl]5-fluorouracil (5c) |
Type | Small organic molecule |
Emp. Form. | C17H17FN10O5 |
Mol. Mass. | 460.3793 |
SMILES | Nc1ncnc2n(Cc3cn(nn3)[C@H]3[C@@H](CO)O[C@H](C3O)n3cc(F)c(=O)[nH]c3=O)cnc12 |r| |
Structure |
|