| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein Nef |
|---|
| Ligand | BDBM288040 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Measurement of Antiviral (HIV-1) Activity |
|---|
| Temperature | 298.15±n/a K |
|---|
| EC50 | 48.0±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Miyazaki, S; Isoshima, H; Oshita, K; Kawashita, S; Nagahashi, N; Terashita, M Substituted spiropyrido[1,2-a]pyrazine derivative and medicinal use thereof as HIV integrase inhibitor US Patent US10087178 Publication Date 10/2/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein Nef |
|---|
| Name: | Protein Nef |
|---|
| Synonyms: | 3ORF | F-protein | HIV-1 Nef | NEF_HV1BR | Negative factor | Protein Nef | nef |
|---|
| Type: | C-terminal core protein |
|---|
| Mol. Mass.: | 23340.47 |
|---|
| Organism: | Human immunodeficiency virus type 1 (isolate BRU/LAI group M subtype B) |
|---|
| Description: | P03406 |
|---|
| Residue: | 206 |
|---|
| Sequence: | MGGKWSKSSVVGWPTVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAATNAACAWLEA
QEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGY
FPDWQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREV
LEWRFDSRLAFHHVARELHPEYFKNC
|
|
|
|---|
| BDBM288040 |
|---|
| n/a |
|---|
| Name | BDBM288040 |
|---|
| Synonyms: | US10087178, Example 21 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H25ClFN3O6S |
|---|
| Mol. Mass. | 525.978 |
|---|
| SMILES | CC(C)N1C[C@]2(C[C@H]2CS(C)(=O)=O)n2cc(C(=O)NCc3cccc(Cl)c3F)c(=O)c(O)c2C1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
