| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aquaporin-1 |
|---|
| Ligand | BDBM178093 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Stopped-flow Assay |
|---|
| IC50 | 1.52e+4± 1.1e+3 nM |
|---|
| Citation |  Patil, RV; Xu, S; van Hoek, AN; Rusinko, A; Feng, Z; May, J; Hellberg, M; Sharif, NA; Wax, MB; Irigoyen, M; Carr, G; Brittain, T; Brown, P; Colbert, D; Kumari, S; Varadaraj, K; Mitra, AK Rapid Identification of Novel Inhibitors of the Human Aquaporin-1 Water Channel. Chem Biol Drug Des87:794-805 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aquaporin-1 |
|---|
| Name: | Aquaporin-1 |
|---|
| Synonyms: | AQP1 | AQP1_HUMAN | Aquaporin-1 (AQP1) | CHIP28 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28528.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 269 |
|---|
| Sequence: | MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSI
ATLAQSVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLT
GNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGH
LLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK
|
|
|
|---|
| BDBM178093 |
|---|
| n/a |
|---|
| Name | BDBM178093 |
|---|
| Synonyms: | [7-(2,4-dichlorophenyl)-5-fluoro-2,3-dihydro-1-benzofuran-2-yl]methanamine (Compound 5) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H12Cl2FNO |
|---|
| Mol. Mass. | 312.166 |
|---|
| SMILES | NCC1Cc2cc(F)cc(c2O1)-c1ccc(Cl)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
