Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM179555 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Surface plasmon resonance (SPR) |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 470.04±n/a nM |
---|
Comments | extracted |
---|
Citation | Ford, D; Porter, JR; Visser, MS; Yusuff, N Compounds for inhibiting the interaction of BCL2 with binding partners US Patent US9126979 Publication Date 9/8/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
Type: | Homodimer or heterodimer |
Mol. Mass.: | 26269.11 |
Organism: | Homo sapiens (Human) |
Description: | P10415 |
Residue: | 239 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM179555 |
---|
n/a |
---|
Name | BDBM179555 |
Synonyms: | US9126979, 12 |
Type | Small organic molecule |
Emp. Form. | C31H40N4O4 |
Mol. Mass. | 532.6737 |
SMILES | CCCCN(CCCC)C(=O)c1cc(C)n(n1)-c1cc(OC)ccc1C(=O)N1Cc2ccccc2C[C@H]1CO |r| |
Structure |
|