| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proto-oncogene tyrosine-protein kinase Src [251-533] |
|---|
| Ligand | BDBM13216 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Kinome-Wide Inhibitor Profiling |
|---|
| Kd | 0.07±0.01 nM |
|---|
| Citation |  Kwarcinski, FE; Brandvold, KR; Phadke, S; Beleh, OM; Johnson, TK; Meagher, JL; Seeliger, MA; Stuckey, JA; Soellner, MB Conformation-Selective Analogues of Dasatinib Reveal Insight into Kinase Inhibitor Binding and Selectivity. ACS Chem Biol11:1296-304 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proto-oncogene tyrosine-protein kinase Src [251-533] |
|---|
| Name: | Proto-oncogene tyrosine-protein kinase Src [251-533] |
|---|
| Synonyms: | Proto-oncogene tyrosine-protein kinase Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | SRC_CHICK |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 32360.42 |
|---|
| Organism: | Gallus gallus (Chicken) |
|---|
| Description: | Wild-type chicken c-Src kinase domain (251-533aa) |
|---|
| Residue: | 283 |
|---|
| Sequence: | QTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQE
AQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQI
ASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTA
PEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPES
LHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
|---|
| BDBM13216 |
|---|
| n/a |
|---|
| Name | BDBM13216 |
|---|
| Synonyms: | BMS-354825 | CHEMBL1421 | DASATINIB | N-(2-Chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyethyl)-1-piperazinyl)]-2-methyl-4-pyrimidinyl]amino)]-1,3-thiazole-5-carboxamide | N-(2-chloro-6-methylphenyl)-2-({6-[4-(2-hydroxyethyl)piperazin-1-yl]-2-methylpyrimidin-4-yl}amino)-1,3-thiazole-5-carboxamide | US10294227, Code Dasatinib | US20230348453, Compound A8 | cid_3062316 | med.21724, Compound Dasatinib |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H26ClN7O2S |
|---|
| Mol. Mass. | 488.006 |
|---|
| SMILES | Cc1nc(Nc2ncc(s2)C(=O)Nc2c(C)cccc2Cl)cc(n1)N1CCN(CCO)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
