Reaction Details |
| Report a problem with these data |
Target | Proto-oncogene tyrosine-protein kinase Src [251-533] |
---|
Ligand | BDBM185673 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Kinome-Wide Inhibitor Profiling |
---|
Kd | 1.7±0.5 nM |
---|
Citation | Kwarcinski, FE; Brandvold, KR; Phadke, S; Beleh, OM; Johnson, TK; Meagher, JL; Seeliger, MA; Stuckey, JA; Soellner, MB Conformation-Selective Analogues of Dasatinib Reveal Insight into Kinase Inhibitor Binding and Selectivity. ACS Chem Biol11:1296-304 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proto-oncogene tyrosine-protein kinase Src [251-533] |
---|
Name: | Proto-oncogene tyrosine-protein kinase Src [251-533] |
Synonyms: | Proto-oncogene tyrosine-protein kinase Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | SRC_CHICK |
Type: | Protein |
Mol. Mass.: | 32360.42 |
Organism: | Gallus gallus (Chicken) |
Description: | Wild-type chicken c-Src kinase domain (251-533aa) |
Residue: | 283 |
Sequence: | QTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQE
AQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQI
ASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTA
PEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPES
LHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
BDBM185673 |
---|
n/a |
---|
Name | BDBM185673 |
Synonyms: | DAS-CHO-II |
Type | Small organic molecule |
Emp. Form. | C28H31N7O3S |
Mol. Mass. | 545.656 |
SMILES | Cc1nc(Nc2ncc(s2)C(=O)Nc2ccc(Oc3ccccc3)cc2C)cc(n1)N1CCN(CCO)CC1 |
Structure |
|