Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein kinase ABL1 [229-512] |
---|
Ligand | BDBM50322535 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Kinome-Wide Inhibitor Profiling |
---|
Kd | 0.7±0.1 nM |
---|
Citation | Kwarcinski, FE; Brandvold, KR; Phadke, S; Beleh, OM; Johnson, TK; Meagher, JL; Seeliger, MA; Stuckey, JA; Soellner, MB Conformation-Selective Analogues of Dasatinib Reveal Insight into Kinase Inhibitor Binding and Selectivity. ACS Chem Biol11:1296-304 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tyrosine-protein kinase ABL1 [229-512] |
---|
Name: | Tyrosine-protein kinase ABL1 [229-512] |
Synonyms: | ABL | ABL1 | ABL1_HUMAN | JTK7 | Tyrosine-protein kinase ABL1 (c-Abl) |
Type: | Protein |
Mol. Mass.: | 32850.19 |
Organism: | Homo sapiens (Human) |
Description: | Human c-Abl kinase domain (229-512aa) |
Residue: | 284 |
Sequence: | SPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAA
VMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQIS
SAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAP
ESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKV
YELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGK
|
|
|
BDBM50322535 |
---|
n/a |
---|
Name | BDBM50322535 |
Synonyms: | 3-(imidazo[1,2-b]pyridazin-3-ylethynyl)-4-methyl-N-{4-[(4-methylpiperazin-1-yl)methyl]-3-(trifluoromethyl)phenyl}benzamide | 3-[2-(Imidazo[1,2-b]pyridazin-3-yl)ethynyl]-4-methyl-N-{4-[(4-methylpiperazin-1-yl)methyl]-3-(trifluoromethyl)phenyl}benzamide | CHEMBL1171837 | PONATINIB | US10464902, Ponatinib | US9255107, AP24534 |
Type | Small organic molecule |
Emp. Form. | C29H27F3N6O |
Mol. Mass. | 532.5595 |
SMILES | CN1CCN(Cc2ccc(NC(=O)c3ccc(C)c(c3)C#Cc3cnc4cccnn34)cc2C(F)(F)F)CC1 |
Structure |
|