Reaction Details |
| Report a problem with these data |
Target | Proto-oncogene tyrosine-protein kinase Src [251-533] |
---|
Ligand | BDBM185676 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | End Point Fluorescence Assay |
---|
pH | 8±n/a |
---|
Kd | 2.8±0.0 nM |
---|
Comments | extracted |
---|
Citation | Kwarcinski, FE; Brandvold, KR; Phadke, S; Beleh, OM; Johnson, TK; Meagher, JL; Seeliger, MA; Stuckey, JA; Soellner, MB Conformation-Selective Analogues of Dasatinib Reveal Insight into Kinase Inhibitor Binding and Selectivity. ACS Chem Biol11:1296-304 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proto-oncogene tyrosine-protein kinase Src [251-533] |
---|
Name: | Proto-oncogene tyrosine-protein kinase Src [251-533] |
Synonyms: | Proto-oncogene tyrosine-protein kinase Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | SRC_CHICK |
Type: | Protein |
Mol. Mass.: | 32360.42 |
Organism: | Gallus gallus (Chicken) |
Description: | Wild-type chicken c-Src kinase domain (251-533aa) |
Residue: | 283 |
Sequence: | QTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQE
AQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQI
ASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTA
PEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPES
LHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
BDBM185676 |
---|
n/a |
---|
Name | BDBM185676 |
Synonyms: | DAS-DFGO-II-BODIPY |
Type | Small organic molecule |
Emp. Form. | C42H40BF5N10O3S |
Mol. Mass. | 870.7 |
SMILES | Cc1cc(C)n2c1C=C1C=CC(CCC(=O)N3CCN(CC3)c3cc(Nc4ncc(s4)C(=O)Nc4cc(NC(=O)c5cccc(c5)C(F)(F)F)ccc4C)nc(C)n3)=[N+]1[B-]2(F)F |c:10,63,t:8| |
Structure |
|