Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCDC7/DBF4 (Cell division cycle 7-related protein kinase/Activator of S phase kinase)
LigandBDBM185841
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7.5±n/a
Ki 2.1±n/a nM
Commentsextracted
Citation Akritopoulou-Zanze IWakefield BDMack HTurner SCGasiecki AFGracias VJSarris KAKalvin DMMichmerhuizen MJShuai QPatel JRBakker MHTeusch NJohnson EFKovar PJDjuric SWLong AJVasudevan AGeorge DMWang LLi BMoore NSHobson ADWoods KWMiyashiro JMSwann, Jr. SLPenning TD 5-substituted indazoles as kinase inhibitors US Patent  US9163007 Publication Date 10/20/2015
More Info.:Get all data from this article,  Assay Method
 
CDC7/DBF4 (Cell division cycle 7-related protein kinase/Activator of S phase kinase)
Name:Cell division cycle 7-related protein kinase
Synonyms:Cell division cycle 7-related protein kinase | Cell division cycle 7-related protein kinase (CDC7)
Type:Protein
Mol. Mass.:63908.16
Organism:Homo sapiens (Human)
Description:O00311
Residue:574
Sequence:
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM185841
n/a
NameBDBM185841
Synonyms:US9163007, 102
TypeSmall organic molecule
Emp. Form.C22H18N6
Mol. Mass.366.4185
SMILESNc1n[nH]c2ccc(cc12)-c1nnn(Cc2ccccc2)c1-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: