Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEZH2(Y641F)
LigandBDBM50075051
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 75±n/a nM
Citation Kuntz KWKnutson SKWigle TJ Inhibitors of human EZH2, and methods of use thereof US Patent  US9175331 Publication Date 11/3/2015
More Info.:Get all data from this article,  Assay Method
 
EZH2(Y641F)
Name:EZH2(Y641F)
Synonyms:Histone-lysine N-methyltransferase EZH2 (Y641F)
Type:n/a
Mol. Mass.:85351.84
Organism:Homo sapiens (Human)
Description:TL
Residue:746
Sequence:
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPA
PAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEFCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50075051
n/a
NameBDBM50075051
Synonyms:CHEMBL3360855 | EPZ005687 | US9175331, 7 | US9637472, Compound C-1
TypeSmall organic molecule
Emp. Form.C32H37N5O3
Mol. Mass.539.6679
SMILESCc1cc(C)c(CNC(=O)c2cc(cc3n(ncc23)C2CCCC2)-c2ccc(CN3CCOCC3)cc2)c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: