| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-10 |
|---|
| Ligand | BDBM192718 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | AlphaLISA-based IL-10 Detection |
|---|
| EC50 | >10000±n/a nM |
|---|
| Citation |  Sundberg, TB; Liang, Y; Wu, H; Choi, HG; Kim, ND; Sim, T; Johannessen, L; Petrone, A; Khor, B; Graham, DB; Latorre, IJ; Phillips, AJ; Schreiber, SL; Perez, J; Shamji, AF; Gray, NS; Xavier, RJ Development of Chemical Probes for Investigation of Salt-Inducible Kinase Function in Vivo. ACS Chem Biol11:2105-11 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-10 |
|---|
| Name: | Interleukin-10 |
|---|
| Synonyms: | IL10 | IL10_HUMAN | Interleukin-10 (IL-10) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20520.59 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 178 |
|---|
| Sequence: | MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
|
|
|
|---|
| BDBM192718 |
|---|
| n/a |
|---|
| Name | BDBM192718 |
|---|
| Synonyms: | HG-9-91-01 derivative, 7 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H41N7O3 |
|---|
| Mol. Mass. | 607.7451 |
|---|
| SMILES | COc1ccc(nc1)N1C(=O)N(Cc2cnc(Nc3ccc(cc3OC(C)C)C3CCN(C)CC3)nc12)c1c(C)cccc1C |
|---|
| Structure | 
|
|---|
Search and Browse
