Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 7 (mGlu7)
LigandBDBM196930
Substrate/Competitorn/a
Meas. Tech.Pharmacological Assay
EC50 13000±1100 nM
Citation Acher FPin JGoudet CEschalier ABusserolles JRigault DLemasson ICesarini SCommare B Hypophosphorous acid derivatives having antihyperalgic activity and biological applications thereof US Patent  US9212196 Publication Date 12/15/2015
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 7 (mGlu7)
Name:Metabotropic glutamate receptor 7 (mGlu7)
Synonyms:Metabotropic glutamate receptor | mGlu7
Type:Enzyme
Mol. Mass.:102244.48
Organism:Rattus norvegicus (Rat)
Description:P35400
Residue:915
Sequence:
MVQLGKLLRVLTLMKFPCCVLEVLLCVLAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRHVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTTNPGYRLIGQWTDELQLNIEDMQWGKGVREIPSSVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQNIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
PAAKKKYVSYNNLVI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM196930
n/a
NameBDBM196930
Synonyms:US9212196, Derivative 26
TypeSmall organic molecule
Emp. Form.C13H18NO7PS
Mol. Mass.363.323
SMILESN[C@H](CCP(O)(=O)C(O)c1ccc(SCC(O)=O)cc1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: