Reaction Details |
| Report a problem with these data |
Target | 3-phosphoinositide-dependent protein kinase 1 [50-359] |
---|
Ligand | BDBM50433916 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Isothermal titration calorimetry |
---|
pH | 7.4±n/a |
---|
Kd | 1250±0.0 nM |
---|
Comments | extracted |
---|
Citation | Schulze, JO; Saladino, G; Busschots, K; Neimanis, S; Süß, E; Odadzic, D; Zeuzem, S; Hindie, V; Herbrand, AK; Lisa, MN; Alzari, PM; Gervasio, FL; Biondi, RM Bidirectional Allosteric Communication between the ATP-Binding Site and the Regulatory PIF Pocket in PDK1 Protein Kinase. Cell Chem Biol23:1193-1205 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-phosphoinositide-dependent protein kinase 1 [50-359] |
---|
Name: | 3-phosphoinositide-dependent protein kinase 1 [50-359] |
Synonyms: | 3-Phosphoinositide dependent protein kinase-1 | PDK1 | PDPK1 | PDPK1_HUMAN |
Type: | n/a |
Mol. Mass.: | 35373.34 |
Organism: | Homo sapiens (Human) |
Description: | O15530[50-359] |
Residue: | 310 |
Sequence: | AMDGTAAEPRPGAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYA
IKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLK
YIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKV
LSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYL
IFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWEN
LHQQTPPKLT
|
|
|
BDBM50433916 |
---|
n/a |
---|
Name | BDBM50433916 |
Synonyms: | PS653 ('1,6-dihydrodibenzo[c,d,g]indazol-6-one) | SP-600125 |
Type | Small organic molecule |
Emp. Form. | C14H8N2O |
Mol. Mass. | 220.2261 |
SMILES | O=C1c2ccccc2-c2[nH]nc3cccc1c23 |
Structure |
|