| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Uracil-DNA glycosylase |
|---|
| Ligand | BDBM208053 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Viral Plaque Reduction Assay |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 21000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Ricciardi, RP; Nuth, M Potent poxvirus inhibitor US Patent US9233921 Publication Date 1/12/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Uracil-DNA glycosylase |
|---|
| Name: | Uracil-DNA glycosylase |
|---|
| Synonyms: | OPG116 | UNG | UNG_VACCC | vaccinia virus D4/A20 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 25083.53 |
|---|
| Organism: | Vaccinia virus (strain Copenhagen) (VACV) |
|---|
| Description: | P20536 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MNSVTVSHAPYTITYHDDWEPVMSQLVEFYNEVASWLLRDETSPIPDKFFIQLKQPLRNK
RVCVCGIDPYPKDGTGVPFESPNFTKKSIKEIASSISRLTGVIDYKGYNLNIIDGVIPWN
YYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDFSNIRAKLESPVTTIVGY
HPAARDRQFEKDRSFEIINVLLELDNKVPINWAQGFIY
|
|
|
|---|
| BDBM208053 |
|---|
| n/a |
|---|
| Name | BDBM208053 |
|---|
| Synonyms: | 7-Methyl-3-((2,4,5-trichlorophenyl)thio)-1H-indole-2-carboxylic acid | US9233921, 30a |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H10Cl3NO2S |
|---|
| Mol. Mass. | 386.68 |
|---|
| SMILES | Cc1cccc2c(Sc3cc(Cl)c(Cl)cc3Cl)c([nH]c12)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
