| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50120439 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Nuetrophil Elastase Acitivty Assay |
|---|
| pH | 7.5±n/a |
|---|
| EC50 | <1±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Gnamm, C; Oost, T; Peters, S; Hoesch, H; Ries, UJ Substituted bicyclic dihydropyrimidinones and their use as inhibitors of neutrophil elastase activity US Patent US9290459 Publication Date 3/22/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50120439 |
|---|
| n/a |
|---|
| Name | BDBM50120439 |
|---|
| Synonyms: | CHEMBL3617975 | US9290459, 47.1 | US9670166, 47.1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H19F3N4O5S |
|---|
| Mol. Mass. | 532.492 |
|---|
| SMILES | CNC(=O)N1[C@@H](C2=C(CCC2=O)N(C1=O)c1cccc(c1)C(F)(F)F)c1ccc(cc1S(C)(=O)=O)C#N |r,t:6| |
|---|
| Structure | 
|
|---|
Search and Browse
