Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-terminal binding protein (CtBP1 R266Q)
LigandBDBM213227
Substrate/Competitorn/a
Meas. Tech.Equilibrium Dialysis
Kd 1.6e+3± 0 nM
Citation Madison DLWirz JASiess DLundblad JR Nicotinamide adenine dinucleotide-induced multimerization of the co-repressor CtBP1 relies on a switching tryptophan. J Biol Chem 288:27836-48 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-terminal binding protein (CtBP1 R266Q)
Name:C-terminal binding protein (CtBP1 R266Q)
Synonyms:n/a
Type:Protein
Mol. Mass.:47508.73
Organism:Homo sapiens (Human)
Description:Human CtBP1 R266Q mutant
Residue:440
Sequence:
MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV
PAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGII
GLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLN
EHNHHLINDFTVKQMRQGAFLVNTAQGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS
QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAAT
HWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHA
PSPGQTVKPEADRDHASDQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM213227
n/a
NameBDBM213227
Synonyms:Nicotinamide adenine dinucleotide (NAD)
TypeSmall organic molecule
Emp. Form.C21H27N7O14P2
Mol. Mass.663.4251
SMILESNC(=O)c1ccc[n+](c1)[C@@H]1O[C@H](COP([O-])(=O)OP(O)(=O)OC[C@H]2O[C@H]([C@H](O)[C@@H]2O)n2cnc3c(N)ncnc23)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: