Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-ketoacyl-ACP synthase (KasA)
LigandBDBM214777
Substrate/Competitorn/a
Meas. Tech.Inhibition Kinetics Assay
pH8.5±n/a
Kd 1.120e+5± 3.0e+3 nM
Commentsextracted
Citation Schiebel JKapilashrami KFekete ABommineni GRSchaefer CMMueller MJTonge PJKisker C Structural basis for the recognition of mycolic acid precursors by KasA, a condensing enzyme and drug target from Mycobacterium tuberculosis. J Biol Chem 288:34190-204 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-ketoacyl-ACP synthase (KasA)
Name:Beta-ketoacyl-ACP synthase (KasA)
Synonyms:β-ketoacyl-ACP synthase I (KasA) | 3-oxoacyl-[acyl-carrier-protein] synthase 1
Type:Protein
Mol. Mass.:43305.57
Organism:Mycobacterium tuberculosis
Description:P9WQD9
Residue:416
Sequence:
MSQPSTANGGFPSVVVTAVTATTSISPDIESTWKGLLAGESGIHALEDEFVTKWDLAVKI
GGHLKDPVDSHMGRLDMRRMSYVQRMGKLLGGQLWESAGSPEVDPDRFAVVVGTGLGGAE
RIVESYDLMNAGGPRKVSPLAVQMIMPNGAAAVIGLQLGARAGVMTPVSACSSGSEAIAH
AWRQIVMGDADVAVCGGVEGPIEALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFG
EAGALMLIETEEHAKARGAKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGL
SPADIDHVNAHGTATPIGDAAEANAIRVAGCDQAAVYAPKSALGHSIGAVGALESVLTVL
TLRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDYRYAVNNSFGFGGHNVALAFGRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM214777
n/a
NameBDBM214777
Synonyms:TLM18
TypeSmall organic molecule
Emp. Form.C14H19N3O2S
Mol. Mass.293.385
SMILESC\C(C=C)=C/[C@@]1(C)SC(=O)C(CCCCN=[N+]=[N-])=C1O |r,c:17|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: