| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Iodotyrosine deiodinase 1 [1-1,32-289] |
|---|
| Ligand | BDBM37633 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | IYD Binding Assay |
|---|
| Kd | 9e+1± 2e+1 nM |
|---|
| Citation |  Ingavat, N; Kavran, JM; Sun, Z; Rokita, SE Active Site Binding Is Not Sufficient for Reductive Deiodination by Iodotyrosine Deiodinase. Biochemistry56:1130-1139 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Iodotyrosine deiodinase 1 [1-1,32-289] |
|---|
| Name: | Iodotyrosine deiodinase 1 [1-1,32-289] |
|---|
| Synonyms: | C6orf71 | DEHAL1 | IYD | IYD1_HUMAN | Iodotyrosine deiodinase (IYD) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29825.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human IYD without its N-terminal transmembrane sequence (2-31 aa) |
|---|
| Residue: | 259 |
|---|
| Sequence: | MGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRS
QEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIR
KIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVH
YYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLLMLLPVGYPSK
EATVPDLKRKPLDQIMVTV
|
|
|
|---|
| BDBM37633 |
|---|
| n/a |
|---|
| Name | BDBM37633 |
|---|
| Synonyms: | (2S)-2-amino-3-(4-hydroxy-3-iodo-phenyl)propionic acid | (2S)-2-amino-3-(4-hydroxy-3-iodophenyl)propanoic acid | (2S)-2-azanyl-3-(3-iodanyl-4-oxidanyl-phenyl)propanoic acid | 3-IODO-L-TYROSINE | 3-Iodo-L-tyrosine (I-Tyr) | MLS000069664 | Monoiodotyrosine | SMR000059143 | cid_439744 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H10INO3 |
|---|
| Mol. Mass. | 307.0851 |
|---|
| SMILES | N[C@@H](Cc1ccc(O)c(I)c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
