| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Urease subunit alpha |
|---|
| Ligand | BDBM221065 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Urease Inhibition Assay |
|---|
| IC50 | 9.1201e+5±n/a nM |
|---|
| Citation |  Abdullah, MA; Abuo-Rahma, GE; Abdelhafez, EM; Hassan, HA; Abd El-Baky, RM Design, synthesis, molecular docking, anti-Proteus mirabilis and urease inhibition of new fluoroquinolone carboxylic acid derivatives. Bioorg Chem70:1-11 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Urease subunit alpha |
|---|
| Name: | Urease subunit alpha |
|---|
| Synonyms: | URE23_HELPY | Urease | hpuA | ureA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26545.30 |
|---|
| Organism: | Helicobacter pylori |
|---|
| Description: | P14916 |
|---|
| Residue: | 238 |
|---|
| Sequence: | MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQE
GRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITI
NEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGE
EKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE
|
|
|
|---|
| BDBM221065 |
|---|
| n/a |
|---|
| Name | BDBM221065 |
|---|
| Synonyms: | 7-(4-((4-((E)-3-(3,4,5-Trimetoxyphenylacryloyl)phenylcarbamoyl)methyl) piperazin-1-yl)-1-cyclopropyl-6-fluoro-1,4-dihydro-4-oxoquinoline-3-carbohydrazide (5e) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H39FN6O7 |
|---|
| Mol. Mass. | 698.74 |
|---|
| SMILES | COc1cc(\C=C\C(=O)c2ccc(NC(=O)CN3CCN(CC3)c3cc4n(cc(C(=O)NN)c(=O)c4cc3F)C3CC3)cc2)cc(OC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
