Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM222121 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | α-Chymotrypsin Inhibition Assay |
---|
pH | 7.6±n/a |
---|
IC50 | 2.39e+4± 6e+2 nM |
---|
Comments | extracted |
---|
Citation | Marasini, BP; Rahim, F; Perveen, S; Karim, A; Mohammed Khan, K; Atta-Ur-Rahman, null; Choudhary, MI Synthesis, structure-activity relationships studies of benzoxazinone derivatives as a-chymotrypsin inhibitors. Bioorg Chem70:210-221 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM222121 |
---|
n/a |
---|
Name | BDBM222121 |
Synonyms: | 2-(3-Methylphenyl)-4H-3,1-benzoxazin-4-one (10) |
Type | Small organic molecule |
Emp. Form. | C15H11NO2 |
Mol. Mass. | 237.2533 |
SMILES | Cc1cccc(c1)-c1nc2ccccc2c(=O)o1 |
Structure |
|