Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDiscoidin domain-containing receptor 2
LigandBDBM223082
Substrate/Competitorn/a
Meas. Tech.LanthaScreen Eu Kinase Activity Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 11.4±4.3 nM
Commentsextracted
Citation Liu LHussain MLuo JDuan AChen CTu ZZhang J Synthesis and biological evaluation of novel dasatinib analogues as potent DDR1 and DDR2 kinase inhibitors. Chem Biol Drug Des 89:420-427 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Discoidin domain-containing receptor 2
Name:Discoidin domain-containing receptor 2
Synonyms:Discoidin domain receptor 2 (DDR2) | Discoidin domain-containing receptor 2 (DDR2) | Epithelial discoidin domain-containing receptor 2 (DDR2)
Type:Protein
Mol. Mass.:96717.07
Organism:Homo sapiens (Human)
Description:n/a
Residue:855
Sequence:
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI
NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV
ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD
DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK
EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS
EITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPD
YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV
PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN
QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMITEYMENG
DLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK
NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET
FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223082
n/a
NameBDBM223082
Synonyms:Ethyl 4-(6-((5-((2-chloro-6-methylphenyl)carbamoyl)thiazol-2-yl)amino)-2-methylpyrimidin-4-yl)-piperazine-1-carboxylate (3b)
TypeSmall organic molecule
Emp. Form.C23H26ClN7O3S
Mol. Mass.516.016
SMILESCCOC(=O)N1CCN(CC1)c1cc(Nc2ncc(s2)C(=O)Nc2c(C)cccc2Cl)nc(C)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: