| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-2 |
|---|
| Ligand | BDBM161398 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | IL-2 ELISA Assay |
|---|
| EC50 | <100±n/a nM |
|---|
| Citation |  Singh, R; Duncton, M; Zhang, J; Alvarez, S; Tso, K; Holland, S; Yen, R; Kolluri, R; Heckrodt, T; Chen, Y; Masuda, E; Li, H; Payan, DG; Kelley, R Protein kinase C inhibitors and uses thereof US Patent US9682976 Publication Date 6/20/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-2 |
|---|
| Name: | Interleukin-2 |
|---|
| Synonyms: | IL-2 | IL2 | IL2_HUMAN | INN=Aldesleukin | Interleukin-2 | Interleukin-2 (IL-2) | T-cell growth factor | TCGF |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17630.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P60568 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
|
|
|
|---|
| BDBM161398 |
|---|
| n/a |
|---|
| Name | BDBM161398 |
|---|
| Synonyms: | US9682976, 76 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H33FN10O |
|---|
| Mol. Mass. | 532.6157 |
|---|
| SMILES | CC1C2CCCN2C(C)(C)CC1Nc1nc(Nc2cc(c(cc2F)C2CC2)-n2nnn(C)c2=O)ncc1C#N |
|---|
| Structure | 
|
|---|
Search and Browse
