Reaction Details |
| Report a problem with these data |
Target | Oxidized purine nucleoside triphosphate hydrolase |
---|
Ligand | BDBM227631 |
---|
Substrate/Competitor | BDBM227639 |
---|
Meas. Tech. | In Vitro MTH1 Enzymatic Assay |
---|
pH | 7.5±n/a |
---|
IC50 | 2.8e+3± 2e+2 nM |
---|
Comments | extracted |
---|
Citation | Kumar, A; Kawamura, T; Kawatani, M; Osada, H; Zhang, KYJ Identification and structure-activity relationship of purine derivatives as novel MTH1 inhibitors. Chem Biol Drug Des89:862-869 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Oxidized purine nucleoside triphosphate hydrolase |
---|
Name: | Oxidized purine nucleoside triphosphate hydrolase |
Synonyms: | 2-hydroxy-dATP diphosphatase | 3.6.1.- | 3.6.1.56 | 7,8-dihydro-8-oxoguanine triphosphatase | 8-oxo-dGTPase | 8ODP_HUMAN | MTH1 | Methylated purine nucleoside triphosphate hydrolase | MutT homolog 1 protein (MTH1) | NUDT1 | Nucleoside diphosphate-linked moiety X motif 1 | Nudix motif 1 | Oxidized purine nucleoside triphosphate hydrolase [42-197] |
Type: | Protein |
Mol. Mass.: | 22514.81 |
Organism: | Homo sapiens (Human) |
Description: | P36639 |
Residue: | 156 |
Sequence: | MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLT
VDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDD
SYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
|
|
|
BDBM227631 |
---|
BDBM227639 |
---|
Name | BDBM227631 |
Synonyms: | MTH1 inhibitor, 14 |
Type | Small organic molecule |
Emp. Form. | C13H13N5 |
Mol. Mass. | 239.2758 |
SMILES | C(Cc1ccccc1)Nc1ncnc2[nH]cnc12 |
Structure |
|