Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein 5 |
---|
Ligand | BDBM60927 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescence Competition Assay |
---|
Kd | 70±6.4 nM |
---|
Citation | Yu, S; Levi, L; Casadesus, G; Kunos, G; Noy, N Fatty acid-binding protein 5 (FABP5) regulates cognitive function both by decreasing anandamide levels and by activating the nuclear receptor peroxisome proliferator-activated receptor ß/d (PPARß/d) in the brain. J Biol Chem289:12748-58 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein 5 |
---|
Name: | Fatty acid-binding protein 5 |
Synonyms: | FABP5_MOUSE | Fabp5 | Fabpe | Fatty acid-binding protein 5 (FABP5) | Klbp | Mal1 |
Type: | Protein |
Mol. Mass.: | 15137.27 |
Organism: | Mus musculus (Mouse) |
Description: | Q05816 |
Residue: | 135 |
Sequence: | MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTV
KTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVEC
VMNNATCTRVYEKVQ
|
|
|
BDBM60927 |
---|
n/a |
---|
Name | BDBM60927 |
Synonyms: | 1-anilinonaphthalene-8-sulfonic acid | 8-Anilino-1-naphthalenesulfonic acid | ANS | Anilinonaphthalene-8-sulfonic acid (ANS) | BDBM50126831 |
Type | n/a |
Emp. Form. | C16H13NO3S |
Mol. Mass. | 299.344 |
SMILES | OS(=O)(=O)c1cccc2cccc(Nc3ccccc3)c12 |
Structure |
|