| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 3 |
|---|
| Ligand | BDBM231167 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Kinetic Assay |
|---|
| pH | 7±n/a |
|---|
| IC50 | >10000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Zhang, Z; Zhang, S Inhibitors of protein tyrosine phosphatases US Patent US9340574 Publication Date 5/17/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 3 |
|---|
| Name: | Dual specificity protein phosphatase 3 |
|---|
| Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 20480.58 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 185 |
|---|
| Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
|---|
| BDBM231167 |
|---|
| n/a |
|---|
| Name | BDBM231167 |
|---|
| Synonyms: | US9340574, 7 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H45BrF2IN6O11P |
|---|
| Mol. Mass. | 1085.619 |
|---|
| SMILES | COc1cc(CC(=O)NCC(NC(=O)C(CCCNC(=O)c2cccc(I)c2)NC(=O)C(Cc2ccc(cc2)C(F)(F)P(O)(O)=O)NC(=O)c2ccc(C)c(Br)c2)C(N)=O)ccc1O |
|---|
| Structure | 
|
|---|
Search and Browse
