| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein kinase ABL1 [131-238] |
|---|
| Ligand | BDBM231649 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization Assay |
|---|
| pH | 7.25±n/a |
|---|
| Kd | >6.192e+4±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Gifford, SM; Liu, W; Mader, CC; Halo, TL; Machida, K; Boggon, TJ; Koleske, AJ Two amino acid residues confer different binding affinities of Abelson family kinase SRC homology 2 domains for phosphorylated cortactin. J Biol Chem289:19704-13 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein kinase ABL1 [131-238] |
|---|
| Name: | Tyrosine-protein kinase ABL1 [131-238] |
|---|
| Synonyms: | ABL | ABL1 | ABL1_HUMAN | Abelson tyrosine-kinase 1 SH2 domain (ABL SH2) | JTK7 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12162.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Truncated human ABL (131-238 aa) |
|---|
| Residue: | 108 |
|---|
| Sequence: | PVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSES
RFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEME
|
|
|
|---|
| BDBM231649 |
|---|
| n/a |
|---|
| Name | BDBM231649 |
|---|
| Synonyms: | EDDTpYDGYE | pY482 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C46H60N9O26P |
|---|
| Mol. Mass. | 1185.9871 |
|---|
| SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CCC(O)=O)C(=O)N[C@@H](Cc1ccc(OP(O)(O)=O)cc1)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
