Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-Glucosidase (α-Glucosidase)
LigandBDBM231687
Substrate/Competitorn/a
Meas. Tech.α-Glucosidase Inhibition Assay
pH6.8±n/a
Temperature310.15±n/a K
IC50 2.53e+3± 2 nM
Commentsextracted
Citation Chaudhry FChoudhry SHuma RAshraf MAl-Rashida MMunir RSohail RJahan BMunawar MAKhan MA Hetarylcoumarins: Synthesis and biological evaluation as potent a-glucosidase inhibitors. Bioorg Chem 73:1-9 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
alpha-Glucosidase (α-Glucosidase)
Name:alpha-Glucosidase (α-Glucosidase)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:68132.36
Organism:Saccharomyces cerevisiae (Baker's yeast)
Description:P38158
Residue:584
Sequence:
MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP
FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK
ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR
QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP
NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEVFSF
THVELGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD
SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF
GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFFLNESFEQGINVEQ
ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF
SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM231687
n/a
NameBDBM231687
Synonyms:6-Bromo-3-(4-(1-(4-chlorophenyl)-4,5-diphenyl-1H-imidazol- 2-yl)-1-phenyl-1H-pyrazol-3-yl)-2H-chromen-2-one (3f)
TypeSmall organic molecule
Emp. Form.C39H24BrClN4O2
Mol. Mass.695.99
SMILESClc1ccc(cc1)-n1c(nc(c1-c1ccccc1)-c1ccccc1)-c1cn(nc1-c1cc2cc(Br)ccc2oc1=O)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: