Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587,Q496K] |
---|
Ligand | BDBM293328 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition of HIV Replication |
---|
pH | 7.55±n/a |
---|
EC50 | <100±n/a nM |
---|
Comments | extracted |
---|
Citation | Kadow, JF; Naidu, BN; Tu, Y Pyridin-3-yl acetic acid derivatives as inhibitors of human immunodeficiency virus replication US Patent US10106504 Publication Date 10/23/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587,Q496K] |
---|
Name: | Gag-Pol polyprotein [489-587,Q496K] |
Synonyms: | HIV-1 Protease Chain A | HIV-1 Protease NL4-3 | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10823.26 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587,Q496K] |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM293328 |
---|
n/a |
---|
Name | BDBM293328 |
Synonyms: | US10106504, Example 65 |
Type | Small organic molecule |
Emp. Form. | C36H41N5O4 |
Mol. Mass. | 607.7418 |
SMILES | Cc1cc(nc(C)n1)N1CCc2cc(ccc2C1)-c1c(N)nc(C)c([C@H](OC(C)(C)C)C(O)=O)c1-c1ccc2OCCCc2c1 |r| |
Structure |
|