| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 1 |
|---|
| Ligand | BDBM26658 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Esterase Activity Assay |
|---|
| pH | 7.4±n/a |
|---|
| Ki | 12800±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Ekinci, D; Karagoz, L; Ekinci, D; Senturk, M; Supuran, CT Carbonic anhydrase inhibitors: in vitro inhibition of a isoforms (hCA I, hCA II, bCA III, hCA IV) by flavonoids. J Enzyme Inhib Med Chem28:283-8 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 1 |
|---|
| Name: | Carbonic anhydrase 1 |
|---|
| Synonyms: | CA-I | CA1 | CAB | CAH1_HUMAN | Carbonate dehydratase I | Carbonic anhydrase | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28873.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00915 |
|---|
| Residue: | 261 |
|---|
| Sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
|
|
|
|---|
| BDBM26658 |
|---|
| n/a |
|---|
| Name | BDBM26658 |
|---|
| Synonyms: | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-1-benzopyran-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone | 2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxychromen-4-one | 2-[2,4-bis(oxidanyl)phenyl]-3,5,7-tris(oxidanyl)chromen-4-one | CHEMBL28626 | MLS000069618 | Morin (19) | Morin (5) | Morin (Mor) | SMR000058259 | cid_5281670 | morin |
|---|
| Type | Flavonoid |
|---|
| Emp. Form. | C15H10O7 |
|---|
| Mol. Mass. | 302.2357 |
|---|
| SMILES | Oc1ccc(c(O)c1)-c1oc2cc(O)cc(O)c2c(=O)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
