Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 3 (CA III)
LigandBDBM7459
Substrate/Competitorn/a
Meas. Tech.Esterase Activity Assay
pH7.4±n/a
Ki 5400±n/a nM
Commentsextracted
Citation Ekinci DKaragoz LEkinci DSenturk MSupuran CT Carbonic anhydrase inhibitors: in vitro inhibition of a isoforms (hCA I, hCA II, bCA III, hCA IV) by flavonoids. J Enzyme Inhib Med Chem 28:283-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 3 (CA III)
Name:Carbonic anhydrase 3 (CA III)
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 | Carbonic anhydrase III
Type:Enzyme
Mol. Mass.:29376.92
Organism:Bos taurus (Cattle)
Description:Q3SZX4
Residue:260
Sequence:
MAKEWGYADHNGPDHWHELFPNAKGENQSPIELNTKEISHDPSLKPWTASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHL
VHWNSKYNSYATALKHADGIAVVGVFLKIGREKGEFQLLLDALDKIKTKGKEAPFNNFNP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRTLYSSAENEPPVPL
VRNWRPPQPIKGRIVKASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7459
n/a
NameBDBM7459
Synonyms:2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-chromen-4-one | CHEMBL151 | Luteolin (27) | Luteolin (4) | cid_5280445 | luteolin
TypeSmall organic molecule
Emp. Form.C15H10O6
Mol. Mass.286.2363
SMILESOc1cc(O)c2c(c1)oc(cc2=O)-c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: