| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Ligand | BDBM50441341 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TR-FRET Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 26230±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Donnell, AF; Han, X; Kester, RF; Kong, N; Le, K; Lou, Y; Michoud, C; Moliterni, JA; Remiszewski, S; Rupert, KC; Yun, W Substituted hetero-azepinones US Patent US9394263 Publication Date 7/19/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Name: | E3 ubiquitin-protein ligase XIAP [241-356] |
|---|
| Synonyms: | API3 | BIR3 domain of X-linked inhibitor of apoptosis protein | BIRC4 | E3 ubiquitin-protein ligase (XIAP-BIR3) | E3 ubiquitin-protein ligase XIAP BIR-3 | E3 ubiquitin-protein ligase XIAP BIR3 | IAP3 | X chromosome-linked inhibitor of apoptosis BIR3 domain (XIAP BIR3) | X-linked inhibitor of apoptosis protein BIR3 domain (XIAP BIR-3) | XIAP | XIAP-BIR3 | XIAP_HUMAN | baculovirus IAP repeat 3 (BIR3) domain of XIAP |
|---|
| Type: | Protein Binding Domain |
|---|
| Mol. Mass.: | 13276.62 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | BIR3 of XIAP: RESIDUES 241-356. |
|---|
| Residue: | 116 |
|---|
| Sequence: | SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
|
|
|
|---|
| BDBM50441341 |
|---|
| n/a |
|---|
| Name | BDBM50441341 |
|---|
| Synonyms: | CHEMBL2431766 | US9394263, 1g |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H32BrN3O5 |
|---|
| Mol. Mass. | 582.485 |
|---|
| SMILES | CN[C@@H](C)C(=O)N[C@@H]1C(=O)N(Cc2c(OC)ccc3cc(Br)ccc23)c2ccccc2OC11CCOCC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
