Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-glucosidase MAL12
LigandBDBM243075
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7±n/a
Ki 1.4e+4± 0 nM
Commentsextracted
Citation Yousefi RAlavian-Mehr MMMokhtari FPanahi FMehraban MHKhalafi-Nezhad A Pyrimidine-fused heterocycle derivatives as a novel class of inhibitors for a-glucosidase. J Enzyme Inhib Med Chem 28:1228-35 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-glucosidase MAL12
Name:Alpha-glucosidase MAL12
Synonyms:α-Glucosidase | Maltase | alpha-Glucosidase (α-Glucosidase)
Type:Protein
Mol. Mass.:68084.32
Organism:Saccharomyces cerevisiae
Description:P53341
Residue:584
Sequence:
MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP
FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK
ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR
QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP
NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEVFSF
THVEVGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD
SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF
GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFLLNESFEQGINVEQ
ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF
SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM243075
n/a
NameBDBM243075
Synonyms:α-Gl inhibitor, C3
TypeSmall organic molecule
Emp. Form.C26H26N6O11S
Mol. Mass.630.583
SMILESNc1ccc(cc1)S(=O)(=O)c1ccc(cc1)N1c2[nH]c(=O)[nH]c(=O)c2C(C(O)C(O)C(O)C(O)CO)c2c1[nH]c(=O)[nH]c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: