Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-regulated kinases 1B
LigandBDBM50434353
Substrate/Competitorn/a
Meas. Tech.HotSpot Technology Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 0.28±n/a nM
Commentsextracted
Citation Leblond BCasagrande ADesire LFoucourt ABesson T DYRK1 inhibitors and uses thereof US Patent  US9446044 Publication Date 9/20/2016
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-regulated kinases 1B
Name:Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Synonyms:DYRK1B | Dual specificity tyrosine-phosphorylation-regulated kinase 1B
Type:Enzyme
Mol. Mass.:69222.24
Organism:Homo sapiens (Human)
Description:Q9Y463
Residue:629
Sequence:
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGA
QLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPHLGLRGVPQSTAASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50434353
n/a
NameBDBM50434353
Synonyms:CHEMBL2386747 | US9446044, 72
TypeSmall organic molecule
Emp. Form.C17H11Cl2N5OS
Mol. Mass.404.273
SMILESCOC(=N)c1nc2ccc3ncnc(Nc4ccc(Cl)cc4Cl)c3c2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: