| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Secreted chorismate mutase |
|---|
| Ligand | BDBM50177405 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | CM Assay |
|---|
| pH | 7.5±0 |
|---|
| Temperature | 310.15±0 K |
|---|
| IC50 | 2.48e+4± 2.2e+3 nM |
|---|
| Citation |  Alokam, R; Jeankumar, VU; Sridevi, JP; Matikonda, SS; Peddi, S; Alvala, M; Yogeeswari, P; Sriram, D Identification and structure-activity relationship study of carvacrol derivatives as Mycobacterium tuberculosis chorismate mutase inhibitors. J Enzyme Inhib Med Chem29:547-54 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Secreted chorismate mutase |
|---|
| Name: | Secreted chorismate mutase |
|---|
| Synonyms: | Chorismate mutase (CM) | Chorismate mutase (MTB CM) | Chorismate mutase-related protein | SCMU_MYCTU |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 21942.03 |
|---|
| Organism: | Mycobacterium tuberculosis H37Rv |
|---|
| Description: | n/a |
|---|
| Residue: | 199 |
|---|
| Sequence: | MLTRPREIYLATAVSIGILLSLIAPLGPPLARADGTSQLAELVDAAAERLEVADPVAAFK
WRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNP
ASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSL
YQRALTTATQSYCQALPPA
|
|
|
|---|
| BDBM50177405 |
|---|
| n/a |
|---|
| Name | BDBM50177405 |
|---|
| Synonyms: | 3-methoxy-4-hydroxybenzaldehyde | 4-hydroxy-3-methoxybenzaldehyde | 4-hydroxy-m-anisaldehyde | CHEMBL13883 | p-hydroxy-m-methoxybenzaldehyde | p-vanillin | vanillin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H8O3 |
|---|
| Mol. Mass. | 152.1473 |
|---|
| SMILES | COc1cc(C=O)ccc1O |
|---|
| Structure | 
|
|---|
Search and Browse
