Reaction Details |
| Report a problem with these data |
Target | Secreted chorismate mutase |
---|
Ligand | BDBM50177405 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | CM Assay |
---|
pH | 7.5±0 |
---|
Temperature | 310.15±0 K |
---|
IC50 | 2.48e+4± 2.2e+3 nM |
---|
Citation | Alokam, R; Jeankumar, VU; Sridevi, JP; Matikonda, SS; Peddi, S; Alvala, M; Yogeeswari, P; Sriram, D Identification and structure-activity relationship study of carvacrol derivatives as Mycobacterium tuberculosis chorismate mutase inhibitors. J Enzyme Inhib Med Chem29:547-54 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Secreted chorismate mutase |
---|
Name: | Secreted chorismate mutase |
Synonyms: | Chorismate mutase (CM) | Chorismate mutase (MTB CM) | Chorismate mutase-related protein | SCMU_MYCTU |
Type: | Protein |
Mol. Mass.: | 21942.03 |
Organism: | Mycobacterium tuberculosis H37Rv |
Description: | n/a |
Residue: | 199 |
Sequence: | MLTRPREIYLATAVSIGILLSLIAPLGPPLARADGTSQLAELVDAAAERLEVADPVAAFK
WRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNP
ASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSL
YQRALTTATQSYCQALPPA
|
|
|
BDBM50177405 |
---|
n/a |
---|
Name | BDBM50177405 |
Synonyms: | 3-methoxy-4-hydroxybenzaldehyde | 4-hydroxy-3-methoxybenzaldehyde | 4-hydroxy-m-anisaldehyde | CHEMBL13883 | p-hydroxy-m-methoxybenzaldehyde | p-vanillin | vanillin |
Type | Small organic molecule |
Emp. Form. | C8H8O3 |
Mol. Mass. | 152.1473 |
SMILES | COc1cc(C=O)ccc1O |
Structure |
|