Reaction Details |
| Report a problem with these data |
Target | Complement factor D |
---|
Ligand | BDBM254475 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Human Complement Factor D Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 4±n/a nM |
---|
Comments | extracted |
---|
Citation | Altmann, E; Hommel, U; Lorthiois, EL; Maibaum, JK; Ostermann, N; Quancard, J; Randl, SA; Rogel, O; Vulpetti, A Pyrrolidine derivatives and their use as complement pathway modulators US Patent US9468661 Publication Date 10/18/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Complement factor D |
---|
Name: | Complement factor D |
Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
Type: | Protein |
Mol. Mass.: | 27039.19 |
Organism: | Homo sapiens (Human) |
Description: | P00746 |
Residue: | 253 |
Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
BDBM254475 |
---|
n/a |
---|
Name | BDBM254475 |
Synonyms: | US9468661, 53 |
Type | Small organic molecule |
Emp. Form. | C28H30Cl2N6O4 |
Mol. Mass. | 585.482 |
SMILES | C[C@@H](NC(=O)[C@@H]1C[C@H]2C[C@H]2N1C(=O)Cn1nc(C(C)=O)c2cc(OCc3ncccn3)c(C)cc12)[C@H]1CC1(Cl)Cl |r| |
Structure |
|