Reaction Details |
| Report a problem with these data |
Target | chymase |
---|
Ligand | BDBM256088 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Enzymatic Chymase Assay |
---|
pH | 7.5±n/a |
---|
IC50 | 2±n/a nM |
---|
Comments | extracted |
---|
Citation | Fürstner, C; Ackerstaff, J; Straub, A; Meier, H; Tinel, H; Zimmermann, K; Tersteegen, A; Zubov, D; Kast, R; Schamberger, J; Schäfer, M; Börngen, K Bicyclically substituted uracils and the use thereof US Patent US9481672 Publication Date 11/1/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
chymase |
---|
Name: | chymase |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 27507.42 |
Organism: | Mesocricetus auratus (Golden hamster) |
Description: | A0A1U7QTH6 |
Residue: | 247 |
Sequence: | MLLPALRLLLFLLGSSAEAGKIIGGTECRPHARPYMAYLEIVTPENHLSACSGFLIRRNF
VMTAAHCAGRSITVLLGAHNKKVKEDTWQKLEVEKQFPHPKYDDHLVLNDIMLLKLKEKA
NLTLGVGTLPISAKSNSIPPGRVCRAVGWGRTNVNEPPSDTLQEVKMRILDPQACKHFED
FHQEPQLCVGNPKKIRNVYKGDSGGPLLCAGIAQGIASYVLRNAKPPSVFTRISHYRPWI
NKILREN
|
|
|
BDBM256088 |
---|
n/a |
---|
Name | BDBM256088 |
Synonyms: | BDBM256092 | BDBM256093 | US9481672, 270 |
Type | Small organic molecule |
Emp. Form. | C24H21ClN4O5 |
Mol. Mass. | 480.9 |
SMILES | Cn1c2ccc(cc2n(C)c1=O)-n1cc(C(O)=O)c(=O)n(C2CCCc3c(Cl)cccc23)c1=O |
Structure |
|