| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Baculoviral IAP repeat-containing protein 2 [174-256] |
|---|
| Ligand | BDBM412169 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TR-FRET Assays for cIAP BIR2 |
|---|
| IC50 | 34.8±n/a nM |
|---|
| Citation |  Flohr, A; Galley, G; Norcross, R; Zorn, N Dimeric compounds US Patent US10398702 Publication Date 9/3/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Baculoviral IAP repeat-containing protein 2 [174-256] |
|---|
| Name: | Baculoviral IAP repeat-containing protein 2 [174-256] |
|---|
| Synonyms: | API1 | BIRC2 | BIRC2_HUMAN | CIAP Bir2 | MIHB | RNF48 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 9527.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13490[174-256] |
|---|
| Residue: | 83 |
|---|
| Sequence: | TNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPK
DDAMSEHRRHFPNCPFLENSLET
|
|
|
|---|
| BDBM412169 |
|---|
| n/a |
|---|
| Name | BDBM412169 |
|---|
| Synonyms: | (3S)-N-[2-[[(3S)-3-[(2,6- difluorophenyl)carbamoyl]- 2-[(2S)-2-[[(2S)-2- (methylamino)propanoyl] amino]-2-(oxan-4-yl)acetyl]- 1,3-dihydroisoindol-5- yl]amino]-2-oxoethyl]-6-[(4- fluorophenyl)methyl]-3- methyl-1-[2-[(2R,5R)-5- methyl-2-[[(3R)-3- methylmorpholin-4- yl]methyl]piperazin-1- yl]acetyl]-2H-indole-3- carboxamide;trihydrochloride | US10398702, Example 8 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C58H71F3N10O8 |
|---|
| Mol. Mass. | 1093.2417 |
|---|
| SMILES | CN[C@@H](C)C(=O)N[C@@H](C1CCOCC1)C(=O)N1Cc2ccc(NC(=O)CNC(=O)[C@]3(C)CN(C(=O)CN4C[C@@H](C)NC[C@@H]4CN4CCOC[C@H]4C)c4cc(Cc5ccc(F)cc5)ccc34)cc2[C@H]1C(=O)Nc1c(F)cccc1F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
