| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-6 |
|---|
| Ligand | BDBM420041 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Interleukin 6 Induction Assay |
|---|
| EC50 | 7.55±n/a nM |
|---|
| Citation |  He, L; Gangwar, S; Posy, SL; Poudel, YB; Sivaprakasam, P Toll-like receptor 7 (TLR7) agonists having a heterobiaryl moiety, conjugates thereof, and methods and uses therefor US Patent US10487084 Publication Date 11/26/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-6 |
|---|
| Name: | Interleukin-6 |
|---|
| Synonyms: | B-cell stimulatory factor 2 | BSF-2 | CDF | CTL differentiation factor | Hybridoma growth factor | IFN-beta-2 | IFNB2 | IL-6 | IL6 | IL6_HUMAN | Interferon beta-2 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 23717.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P05231 |
|---|
| Residue: | 212 |
|---|
| Sequence: | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
|
|
|
|---|
| BDBM420041 |
|---|
| n/a |
|---|
| Name | BDBM420041 |
|---|
| Synonyms: | US10487084, Compound Ib-02 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23N7O2S |
|---|
| Mol. Mass. | 425.507 |
|---|
| SMILES | CCCCOc1nc(N)c2nc(O)n(Cc3ccc(nc3)-c3csc(CN)c3)c2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
