| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 6 |
|---|
| Ligand | BDBM444595 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | LANCE Ultra ULight Assay |
|---|
| IC50 | 1.41±n/a nM |
|---|
| Citation |  Xia, G; Wang, Q; Shi, C; Zhai, X; Ge, H; Liao, X; Mao, Y; Xiang, Z; Han, Y; Huo, G; Liu, Y Substituted pyrimidines as cyclin-dependent kinase inhibitors US Patent US10662186 Publication Date 5/26/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 6 |
|---|
| Name: | Cyclin-dependent kinase 6 |
|---|
| Synonyms: | CDK6 | CDK6_HUMAN | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 (CDK 6) | Serine/threonine-protein kinase PLSTIRE |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 36937.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q00534 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
|
|
|
|---|
| BDBM444595 |
|---|
| n/a |
|---|
| Name | BDBM444595 |
|---|
| Synonyms: | US10662186, Compound 131 | US10988476, Compound I-131 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H32F2N8 |
|---|
| Mol. Mass. | 530.6148 |
|---|
| SMILES | CN1CCC[C@H]1CN1CCc2nc(Nc3ncc(F)c(n3)-c3cc(F)c4nc(C)n(C5CC5)c4c3)ccc2C1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
