| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Plasminogen [101-181] |
|---|
| Ligand | BDBM290313 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Plasma-Based Clot Lysis Assay |
|---|
| IC50 | 14.0±n/a nM |
|---|
| Citation |  Haßfeld, J; Kinzel, T; Köbberling, J; Cancho-Grande, Y; Beyer, K; Röhrig, S; Köllnberger, M; Sperzel, M; Burkhardt, N; Schlemmer, K; Stegmann, C; Schuhmacher, J; Werner, M; Ellermann, M (Aza)pyridopyrazolopyrimidinones and indazolopyrimidinones and their use US Patent US10668071 Publication Date 6/2/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Plasminogen [101-181] |
|---|
| Name: | Plasminogen [101-181] |
|---|
| Synonyms: | PLG | PLMN_HUMAN | Plasminogen (aa 101-181) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 9281.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00747[101-181] |
|---|
| Residue: | 81 |
|---|
| Sequence: | SECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQ
GPWCYTTDPEKRYDYCDILEC
|
|
|
|---|
| BDBM290313 |
|---|
| n/a |
|---|
| Name | BDBM290313 |
|---|
| Synonyms: | 10-Phenyl-4-(piperidin-4-yl)pyrimido[1,2-b]indazol-2(1H)-one hydrochloride | US10098883, Example 56 | US10668071, Example 56 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20N4O |
|---|
| Mol. Mass. | 344.4097 |
|---|
| SMILES | O=c1cc(C2CCNCC2)n2nc3cccc(-c4ccccc4)c3c2[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
