| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxidized low-density lipoprotein receptor 1 |
|---|
| Ligand | BDBM454257 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| IC50 | >300±n/a nM |
|---|
| Citation |  Findlay, AD; Turner, CI; Deodhar, M; Foot, JS; Jarolimek, W; Zhou, W; Robertson, AD Haloallylamine indole and azaindole derivative inhibitors of lysyl oxidases and uses thereof US Patent US10717733 Publication Date 7/21/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Oxidized low-density lipoprotein receptor 1 |
|---|
| Name: | Oxidized low-density lipoprotein receptor 1 |
|---|
| Synonyms: | LOX-1 | LOX1 | Lectin-like oxLDL receptor 1 | Lectin-like oxidized LDL receptor 1 | Lectin-type oxidized LDL receptor 1 | OLR1 | OLR1_BOVIN | Ox-LDL receptor 1 | bLOX-1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30894.65 |
|---|
| Organism: | Bovine |
|---|
| Description: | P79391 |
|---|
| Residue: | 270 |
|---|
| Sequence: | MTVDDPKGMKDQLDQKPNGKTAKGFVSSWRWYPAAVTLGVLCLGLLVTVILLILQLSQVS
DLIKKQQANITHQEDILEGQILAQRRSEKSAQESQKELKEMIETLAHKLDEKSKKLMELH
RQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSSGSFNWEKSQENCLSLDAHLLKINS
TDELEFIQQMIAHSSFPFWMGLSMRKPNYSWLWEDGTPLTPHLFRIQGAVSRMYPSGTCA
YIQRGTVFAENCILTAFSICQKKANLLRAQ
|
|
|
|---|
| BDBM454257 |
|---|
| n/a |
|---|
| Name | BDBM454257 |
|---|
| Synonyms: | (Z)-1-(4-amino-2-fluorobut-2-en-1-yl)- N,N,2-trimethyl-3-(3- (methylsulfonyl)phenyl)-1H-indole-5- carboxamide | US10717733, Compound 50 | US11098045, Compound 50 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H26FN3O3S |
|---|
| Mol. Mass. | 443.534 |
|---|
| SMILES | CN(C)C(=O)c1ccc2n(C\C(F)=C\CN)c(C)c(-c3cccc(c3)S(C)(=O)=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
