| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Monoacylglycerol lipase ABHD6 |
|---|
| Ligand | BDBM280567 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Competitive Activity-Based Protein Profiling Assay |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Buzard, DJ; Shaghafi, MB; Cisar, JS; Grice, CA; Jones, TK; Weber, OD Spirocycle compounds and methods of making and using same US Patent US10781211 Publication Date 9/22/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Monoacylglycerol lipase ABHD6 |
|---|
| Name: | Monoacylglycerol lipase ABHD6 |
|---|
| Synonyms: | ABHD6_MOUSE | Abh6 | Abhd6 | Abhydrolase Domain-Containing Protein 6 | Monoacylglycerol lipase ABHD6 |
|---|
| Type: | Single-pass type II membrane protein; hydrolase |
|---|
| Mol. Mass.: | 38216.17 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Assays were using membranes of recombinant Abh6 transiently transfected in COS-7 cells. |
|---|
| Residue: | 336 |
|---|
| Sequence: | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
|
|
|
|---|
| BDBM280567 |
|---|
| n/a |
|---|
| Name | BDBM280567 |
|---|
| Synonyms: | US10030020, Example 112 | US10781211, Example 112 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30ClF6N3O3 |
|---|
| Mol. Mass. | 569.967 |
|---|
| SMILES | FC(F)(F)C(OC(=O)N1CCC2(CCCN2Cc2cccc(N3CC4COCC4C3)c2Cl)CC1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
