Reaction Details |
| Report a problem with these data |
Target | Monoacylglycerol lipase ABHD6 |
---|
Ligand | BDBM280567 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Competitive Activity-Based Protein Profiling Assay |
---|
IC50 | >1000±n/a nM |
---|
Citation | Buzard, DJ; Shaghafi, MB; Cisar, JS; Grice, CA; Jones, TK; Weber, OD Spirocycle compounds and methods of making and using same US Patent US10781211 Publication Date 9/22/2020 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Monoacylglycerol lipase ABHD6 |
---|
Name: | Monoacylglycerol lipase ABHD6 |
Synonyms: | ABHD6_MOUSE | Abh6 | Abhd6 | Abhydrolase Domain-Containing Protein 6 | Monoacylglycerol lipase ABHD6 |
Type: | Single-pass type II membrane protein; hydrolase |
Mol. Mass.: | 38216.17 |
Organism: | Mus musculus (mouse) |
Description: | Assays were using membranes of recombinant Abh6 transiently transfected in COS-7 cells. |
Residue: | 336 |
Sequence: | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
|
|
|
BDBM280567 |
---|
n/a |
---|
Name | BDBM280567 |
Synonyms: | US10030020, Example 112 | US10781211, Example 112 |
Type | Small organic molecule |
Emp. Form. | C25H30ClF6N3O3 |
Mol. Mass. | 569.967 |
SMILES | FC(F)(F)C(OC(=O)N1CCC2(CCCN2Cc2cccc(N3CC4COCC4C3)c2Cl)CC1)C(F)(F)F |
Structure |
|