| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Probable integral membrane cytochrome D ubiquinol oxidase (Subunit II) CydB (Cytochrome BD-I oxidase subunit II) |
|---|
| Ligand | BDBM466333 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Mtb cytochrome bd inhibition assay |
|---|
| IC50 | 100.0±20 nM |
|---|
| Citation |  Biagini, GA; Ward, SA; Nixon, GL; O''Neill, PM Combination of respiratory electron transport chain inhibitors with a cytochrome bd inhibitor US Patent US10799494 Publication Date 10/13/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Probable integral membrane cytochrome D ubiquinol oxidase (Subunit II) CydB (Cytochrome BD-I oxidase subunit II) |
|---|
| Name: | Probable integral membrane cytochrome D ubiquinol oxidase (Subunit II) CydB (Cytochrome BD-I oxidase subunit II) |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 37630.78 |
|---|
| Organism: | n/a |
|---|
| Description: | O06139 |
|---|
| Residue: | 346 |
|---|
| Sequence: | MVLQELWFGVIAALFLGFFILEGFDFGVGMLMAPFAHVGMGDPETHRRTALNTIGPVWDG
NEVWLITAGAAIFAAFPGWYATVFSALYLPLLAILFGMILRAVAIEWRGKIDDPKWRTGA
DFGIAAGSWLPALLWGVAFAILVRGLPVDANGHVALSIPDVLNAYTLLGGLATAGLFSLY
GAVFIALKTSGPIRDDAYRFAVWLSLPVAGLVAGFGLWTQLAYGKDWTWLVLAVAGCAQA
AATVLVWRRVSDGWAFMCTLIVVAAVVVLLFGALYPNLVPSTLNPQWSLTIHNASSTPYT
LKIMTWVTAFFAPLTVAYQTWTYWVFRQRISAERIPPPTGLARRAP
|
|
|
|---|
| BDBM466333 |
|---|
| n/a |
|---|
| Name | BDBM466333 |
|---|
| Synonyms: | US10799494, Compound LT-9 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H18FNO |
|---|
| Mol. Mass. | 343.3935 |
|---|
| SMILES | Cc1c([nH]c2ccccc2c1=O)-c1ccc(Cc2ccc(F)cc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
