| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein-lysine 6-oxidase |
|---|
| Ligand | BDBM469012 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | LOX Enzyme Activity Assay |
|---|
| IC50 | 1300±n/a nM |
|---|
| Citation |  Springer, C; Marais, R; Niculescu-Duvaz, D; Leung, L; Smithen, D; Callens, C; Tang, H Methylamine derivatives as lysysl oxidase inhibitors for the treatment of cancer US Patent US10807974 Publication Date 10/20/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein-lysine 6-oxidase |
|---|
| Name: | Protein-lysine 6-oxidase |
|---|
| Synonyms: | LOX | LYOX_PIG |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28737.77 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_108023 |
|---|
| Residue: | 246 |
|---|
| Sequence: | DDPYNPYKYSDDNPYYNYYERPRPGSRYRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKM
SMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSC
HQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGC
YDTYNADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASG
CTISPY
|
|
|
|---|
| BDBM469012 |
|---|
| n/a |
|---|
| Name | BDBM469012 |
|---|
| Synonyms: | US10807974, Example 28 | US10995088, Example 28 | US11608330, Example 28 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H17NO5S3 |
|---|
| Mol. Mass. | 375.483 |
|---|
| SMILES | COCCS(=O)(=O)c1ccc(cc1)S(=O)(=O)c1ccc(CN)s1 |
|---|
| Structure | 
|
|---|
Search and Browse
