| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Receptor activity-modifying protein 1 |
|---|
| Ligand | BDBM391717 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Radioligand binding assay |
|---|
| Ki | 0.100±n/a nM |
|---|
| Citation |  Christopher, JA; Congreve, MS; Bucknell, SJ; Deflorian, F; Pickworth, M; Mason, JS CGRP receptor antagonists US Patent US10888561 Publication Date 1/12/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Receptor activity-modifying protein 1 |
|---|
| Name: | Receptor activity-modifying protein 1 |
|---|
| Synonyms: | Calcitonin-gene-related peptide receptor, CALCRL/RAMP1 | RAMP1 | RAMP1_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16992.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | EBI_100673 |
|---|
| Residue: | 148 |
|---|
| Sequence: | MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV
|
|
|
|---|
| BDBM391717 |
|---|
| n/a |
|---|
| Name | BDBM391717 |
|---|
| Synonyms: | US10300056, Example 2 | US10888561, Example 2 | tert-butyl 4-{(2S)-2- |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H60N10O6 |
|---|
| Mol. Mass. | 873.0534 |
|---|
| SMILES | Cc1cc(C[C@@H](NC(=O)N2CCC(CC2)c2cc3ccccc3[nH]c2=O)C(=O)N[C@@H](CC2CCN(CC2)C(=O)OC(C)(C)C)C(=O)N2CCN(CC2)c2ccncc2)cc2cn[nH]c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
