| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Ligand | BDBM481682 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization Assay |
|---|
| Kd | 16±n/a nM |
|---|
| Citation |  Waldmann, H; Martin-Gago, PA; Murarka, S; Klein, C; Bastiaens, P; Wittinghofer, A; Fansa, EK Benzene disulfonamide for the treatment of cancer US Patent US10913710 Publication Date 2/9/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Name: | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Synonyms: | 3',5'-cyclic phosphodiesterase | GMP-PDE delta | PDE6D | PDE6D_HUMAN | PDED | Protein p17 | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17418.30 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_105761 |
|---|
| Residue: | 150 |
|---|
| Sequence: | MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVS
RELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPA
SVLTGNVIIETKFFDDDLLVSTSRVRLFYV
|
|
|
|---|
| BDBM481682 |
|---|
| n/a |
|---|
| Name | BDBM481682 |
|---|
| Synonyms: | N1-benzyl-N4-cyclopentyl-N1- (pyridin-2-ylmethyl)benzene-1,4- disulfonamide | US10913710, Compound 92 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H27N3O4S2 |
|---|
| Mol. Mass. | 485.619 |
|---|
| SMILES | O=S(=O)(NC1CCCC1)c1ccc(cc1)S(=O)(=O)N(Cc1ccccc1)Cc1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
