Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-1
LigandBDBM168465
Substrate/Competitorn/a
Meas. Tech.ET-1 Assay
EC50>200000±n/a nM
Citation PubChem PCBuckman BONicholas JBRamphal JYEmayan KSeiwert SD Anti-fibrotic pyridinones US Patent  US9675593 Publication Date 6/13/2017
More Info.:Get all data from this article,  Assay Method
 
Endothelin-1
Name:Endothelin-1
Synonyms:PPET1 | Preproendothelin-1
Type:Protein
Mol. Mass.:24444.51
Organism:Homo sapiens (Human)
Description:P05305
Residue:212
Sequence:
MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW
NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM168465
n/a
NameBDBM168465
Synonyms:US9675593, 25
TypeSmall organic molecule
Emp. Form.C19H21N3O3
Mol. Mass.339.3883
SMILESCOCCOc1ccc(cc1)-n1cc(-c2cnn(C)c2)c(C)cc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: