Compile Data Set for Download or QSAR
Found 150 Enz. Inhib. hit(s) with Target = 'Activin receptor type-2A'
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557751(CHEMBL4792978)copy SMILES
Affinity DataIC50: 180nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557745(CHEMBL4741913)copy SMILES
Affinity DataIC50: 190nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557742(CHEMBL4752199)copy SMILES
Affinity DataIC50: 310nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557760(CHEMBL4749011)copy SMILES
Affinity DataIC50: 530nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557743(CHEMBL4744988)copy SMILES
Affinity DataIC50: 630nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557744(CHEMBL4741185)copy SMILES
Affinity DataIC50: 700nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557762(CHEMBL4747422)copy SMILES
Affinity DataIC50: 800nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557763(CHEMBL4744618)copy SMILES
Affinity DataIC50: 860nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557752(CHEMBL4763122)copy SMILES
Affinity DataIC50: 960nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557747(CHEMBL4795223)copy SMILES
Affinity DataIC50: 1.10E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557741(CHEMBL4750258)copy SMILES
Affinity DataIC50: 1.20E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557739(CHEMBL4798505)copy SMILES
Affinity DataIC50: 1.20E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557746(CHEMBL4779579)copy SMILES
Affinity DataIC50: 1.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557749(CHEMBL4783244)copy SMILES
Affinity DataIC50: 1.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557756(CHEMBL4779273)copy SMILES
Affinity DataIC50: 1.90E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557765(CHEMBL4791414)copy SMILES
Affinity DataIC50: 2.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557761(CHEMBL4758580)copy SMILES
Affinity DataIC50: 2.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50466183(CHEMBL4283638)copy SMILEScopy InChI
Affinity DataIC50: 2.37E+3nMAssay Description:Inhibition of full length GST-tagged human ACVR2A expressed in Baculovirus expression system by LanthaScreen assayMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2NZ8BBTPubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557764(CHEMBL4787891)copy SMILES
Affinity DataIC50: 2.40E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557754(CHEMBL4764416)copy SMILES
Affinity DataIC50: 2.70E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557767(CHEMBL4764221)copy SMILES
Affinity DataIC50: 2.90E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557755(CHEMBL4782729)copy SMILES
Affinity DataIC50: 2.90E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557759(CHEMBL4763627)copy SMILES
Affinity DataIC50: 3.00E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557766(CHEMBL4751832)copy SMILES
Affinity DataIC50: 3.00E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557740(CHEMBL4777071)copy SMILES
Affinity DataIC50: 3.00E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557753(CHEMBL4748097)copy SMILES
Affinity DataIC50: 3.80E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557757(CHEMBL4792464)copy SMILES
Affinity DataIC50: 4.10E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557758(CHEMBL4749061)copy SMILES
Affinity DataIC50: 5.30E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50401152(CHEMBL2205766)copy SMILEScopy InChI
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of ACVR2AMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2HQ412BPubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557750(CHEMBL4747912)copy SMILES
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50557748(CHEMBL4745367)copy SMILES
Affinity DataIC50: 2.00E+4nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM13216(BMS-354825 | CHEMBL1421 | DASATINIB | N-(2-Chloro-...)copy SMILEScopy InChI
Affinity DataKd:  210nMAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2KH0KQHPCBioAssay
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM6866(1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b ...)copy SMILEScopy InChI
Affinity DataKd:  2.90E+3nMAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
In DepthDetails
BindingDB Entry DOI: 10.7270/Q2KH0KQHPCBioAssay
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50308060(16-hydroxy-16-(hydroxymethyl)-15-methyl-28-oxa-4,1...)copy SMILEScopy InChI
Affinity DataKd:  2.50E+3nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PN95V2PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50326053(CHEMBL608533 | PKC-412)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PN95V2PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50026612(BIBF-1120 | Nintedanib | US10981896, Compound Nint...)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25D8S70PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)copy SMILEScopy InChI
Affinity DataKd:  8.90E+3nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25D8S70PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50326053(CHEMBL608533 | PKC-412)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25D8S70PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50308060(16-hydroxy-16-(hydroxymethyl)-15-methyl-28-oxa-4,1...)copy SMILEScopy InChI
Affinity DataKd:  2.50E+3nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25D8S70PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50326053(CHEMBL608533 | PKC-412)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2TT4RX2PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2TT4RX2PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM16673(4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamo...)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PN95V2PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM13535(4-[6-methoxy-7-(3-piperidin-1-ylpropoxy)quinazolin...)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PN95V2PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50326054(CHEMBL1240703)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PN95V2PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM4814(CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fl...)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PN95V2PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50300690(1-(5-Tert-Butyl-1,2-Oxazol-3-Yl)-3-(4-{7-[2-(Morph...)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding affinity to ACVR2AMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q2PN95V2PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM50322823((S)-N-(4-(3-chloro-4-fluorophenylamino)-7-(tetrahy...)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25D8S70PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM5446(CHEMBL553 | ERLOTINIB HYDROCHLORIDE | Erlotinib | ...)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25D8S70PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM36409(2-(4-amino-1-isopropyl-1H-pyrazolo[3,4-d]pyrimidin...)copy SMILEScopy InChI
Affinity DataKd:  18nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25D8S70PubMed
TargetActivin receptor type-2A(Homo sapiens (Human))TBA
LigandPNGBDBM12621(2,4-Diamino-5-ketopyrimidine 39 | 5-[(2,3-difluoro...)copy SMILEScopy InChI
Affinity DataKd: >1.00E+4nMAssay Description:Binding constant for ACVR2A kinase domainMore data for this Ligand-Target Pair
In DepthDetails Article
BindingDB Entry DOI: 10.7270/Q25D8S70PubMed
Displayed 1 to 50 (of 150 total ) | Next | Last >>
Jump to: